Source: Ma, Z., et al. Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells. J. Vis. Exp. (2017).
This video demonstrates tandem affinity purification — a technique to purify protein complexes from eukaryotic cells to study protein-protein interaction. The complex contains two proteins labeled with different epitope tags. Upon the purification of the complex using two resins with an affinity for the two different tags in a sequential manner, the presence of both proteins in the elute confirms the interaction between the two.
1. Plating Cells
2. Transfecting Cells or Inducing Stable Cell Lines
3. Checking Transfection or Induction Efficiency
4. STREP Affinity Purification (STREP AP)
5. FLAG IP
Table 1: Plasmids used in this Study. CycT1 and CDK9 were ligated into the pcDNA/4TO-STREP and pcDNA/4TO-FLAG plasmid vectors. These constructs were transformed into DH5α competent cells and plated on LB-Ampicillin plates. Colonies were selected, grown, and screened. Successfully ligated clones were verified by Sanger sequencing and the combination of restriction digestion and agarose gel electrophoresis. For CycT1 we used a shorter version (1 – 708) instead of the full-length (1 – 726) because the last 18 residues contain a PEST sequence (a peptide sequence rich in proline, glutamic acid, serine, and threonine), which acts as a signal peptide for protein degradation. CDK9 was full-length. The sequence of the tandem STREP tag is as follows: GGGGWSHPQFEKGGGSGGGSGGGSWSHPQFEK. The sequence of the tandem FLAG tag is as follows: GGGGDYKDHDGDYKDHDIDYKDDDDK.
Protein | Residues | Vector | Tag | Cloning sites | Reference |
CycT1 | 1-708 | pcDNA/4TO | STREP | HindIII – EcoRI | McNamara et al., 2013 |
CycT1 | 1-708 | pcDNA/4TO | FLAG | HindIII – EcoRI | This article |
CDK9 | 1-372 | pcDNA/4TO | STREP | HindIII – XhoI | This article |
CDK9 | 1-372 | pcDNA/4TO | FLAG | HindIII – XhoI | McNamara et al., 2013 |
GFP | 1-238 | pcDNA/4TO | STREP-FLAG | BamHI – XhoI | This article |
The authors have nothing to disclose.
Dulbecco's Modified Eagle Medium (DMEM) | Fisher Scientific | SH30022FS | |
Fetal bovine serum | Hyclone | SH30071 | |
Penicillin/Streptomycin | Fisher Scientific | MP091670049 | |
PolyJet | Fisher Scientific | 50-478-8 | |
Protease inhibitor cocktail | Roche | 11836153001 | |
STREP-Tactin Superflow | IBA | 2-1208-010 | |
STREP-tag elution buffer | IBA | 2-1000-025 | |
EZview Red ANTI-FLAG M2 Affinity Gel | Sigma | SLBQ1981V | |
Corning 100mm × 20 mm style Dish cell culture treated nonpyrogenic polystyrene 20/sleeve | Corning | 430167 | |
Protein Lo-Bind Eppendorf | Fisher Scientific | 13-698-794 | |
Digital Vortex Mixer | Fisher Scientific | 02-215-370 | |
48-hole micro tube foam rack | Fisher Scientific | 02-215-386 | |
Labquake shaker rotisserie | Thermo | 415110 |